PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009622827.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 285aa    MW: 32204.8 Da    PI: 4.6083
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009622827.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.67e-2164117356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k++++t+eq++ Le+ Fe ++++  e++++LAkklgL+ rqV vWFqNrRa++k
  XP_009622827.1  64 KKRRLTPEQVHLLEKSFEAENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWK 117
                     5678*************************************************9 PP

2HD-ZIP_I/II133.48.1e-4363154192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     ekkrrl+ eqv+lLE+sFe+e+kLeperK++la++LglqprqvavWFqnrRAR+ktk lE+dy++Lk++yd+l ++ ++++k++e+L++e+ 
  XP_009622827.1  63 EKKRRLTPEQVHLLEKSFEAENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKTLERDYDQLKSSYDSLLSDFDSIRKDNEKLKAEVV 154
                     69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.28E-2050119IPR009057Homeodomain-like
PROSITE profilePS5007118.36659119IPR001356Homeobox domain
SMARTSM003895.7E-2062123IPR001356Homeobox domain
PfamPF000464.2E-1864117IPR001356Homeobox domain
CDDcd000862.63E-1964119No hitNo description
Gene3DG3DSA:1.10.10.607.6E-2265126IPR009057Homeodomain-like
PRINTSPR000314.3E-69099IPR000047Helix-turn-helix motif
PROSITE patternPS00027094117IPR017970Homeobox, conserved site
PRINTSPR000314.3E-699115IPR000047Helix-turn-helix motif
PfamPF021831.1E-16119161IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MGSGHIFFDP SCHGNMLFLG NSDPVFRGPR SMMKMEDSSK RRPFFSSPEE LYDEEYYDEQ  60
SPEKKRRLTP EQVHLLEKSF EAENKLEPER KTQLAKKLGL QPRQVAVWFQ NRRARWKTKT  120
LERDYDQLKS SYDSLLSDFD SIRKDNEKLK AEVVSLMEKL QGKVVGEAGV INEKCEVLEV  180
DALTLQVKVK AEDRLSSGSG GSAVVDEHSP QLVDSGDSYF HTGHMEEYPL GAGGCNNIPP  240
PMDGLQSEED DGSDDGGGHG YFCNVFVAAE EQQHEEGEPI GWFWS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAPTransfer from AT3G01470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ8087580.0KJ808758.1 Nicotiana tabacum homeodomain leucine zipper protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009622827.10.0PREDICTED: homeobox-leucine zipper protein HAT5
RefseqXP_016509870.10.0PREDICTED: homeobox-leucine zipper protein HAT5-like
SwissprotQ022832e-93HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLA0A076L2020.0A0A076L202_TOBAC; Homeodomain leucine zipper protein
STRINGPGSC0003DMT4000013221e-176(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA78912330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-79homeobox 1